Pepacorn
← Compounds

Semaglutide

peptide · headlineResearch use only

GLP-1 receptor agonism: enhances insulin secretion, delays gastric emptying, reduces appetite

Overview

Semaglutide is a long-acting GLP-1 receptor agonist peptide used for weight management and glycemic control. It reduces appetite and caloric intake while enhancing insulin secretion and delaying gastric emptying. Available as Ozempic (for diabetes) and Wegovy (for obesity), it is a proven tool in treating metabolic syndrome and aiding fat loss when combined with lifestyle interventions.

How it works

  • GLP-1 receptor agonism: enhances insulin secretion, delays gastric emptying, reduces appetite
  • Suppresses glucagon secretion
  • Acts on brain centers regulating appetite and satiety

Dosing

0.25 mg weekly for 4 weeks, titrated upward every 2–4 weeks to a maximum of 2.4 mg weekly.

Subcutaneous (SQ)1 mg standardrange 0.252.4 mg· Once weekly

Caution: Start at low dose to minimize GI side effects. Do not combine with other incretin-based therapies unless supervised.

Cycling

  • Typical protocol: 0.25 mg/week for 4 weeks → 0.5 mg → 1 mg → 1.7 mg → 2.4 mg. Duration 12–24 weeks. Break for 4–6 weeks between cycles.

Side effects

Common
  • GI effects: nausea, vomiting, diarrhea, constipation — decrease with gradual titration
  • Hypoglycemia risk when combined with insulin or sulfonylureas
Warnings
  • Rare: pancreatitis, gallbladder disease, acute kidney injury
  • Thyroid C-cell tumors observed in rodents (human relevance uncertain)

Stacking & combinations

With

MOTS-c

Benefit

Supports retention of lean muscle mass during calorie restriction

With

ARA-290

Benefit

Enhances fat metabolism and lipolysis

With

AOD-9604

Benefit

Improves metabolic flexibility and may reduce leptin resistance

Lifestyle support

Diet

Consistent meal schedule with whole foods, lean proteins, and vegetables. Monitor appetite changes. Stay well-hydrated (2–3 liters daily).

Sleep

Adequate rest for metabolic support.

Timing

Weekly injection. Consistent day each week.

Exercise

Exercise 4–5 times weekly with mix of cardio and resistance.

Research studies

Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.

Research study

Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP-1)

Wilding JPH, Batterham RL, Calanna S, et al. N Engl J Med. 2021;384(11):989–1002. View source ↗

Scientific findings

The STEP-1 trial randomized 1,961 adults with body mass index ≥30 (or ≥27 with weight-related comorbidities and without diabetes) to once-weekly subcutaneous semaglutide 2.4 mg or placebo for 68 weeks, alongside lifestyle intervention. Mean change in body weight was -14.9% in the semaglutide arm versus -2.4% in placebo. Secondary endpoints — including weight reduction ≥5%, ≥10%, and ≥15% — favored semaglutide with high statistical significance. Adverse events were predominantly gastrointestinal and consistent with the known GLP-1 receptor agonist class profile.

Plain English

Researchers ran a large 68-week study comparing weekly semaglutide injections to placebo in nearly 2,000 adults with overweight or obesity (without diabetes). On average, the semaglutide group lost about 15% of their starting body weight; the placebo group lost about 2%. The most common side effects were stomach-related (nausea, diarrhea), which is typical for this class of molecule.

Research study

Semaglutide and Cardiovascular Outcomes in Patients with Type 2 Diabetes (SUSTAIN-6)

Marso SP, Bain SC, Consoli A, et al. N Engl J Med. 2016;375(19):1834–1844. View source ↗

Scientific findings

SUSTAIN-6 was a randomized, double-blind cardiovascular outcomes trial in 3,297 patients with type 2 diabetes at high cardiovascular risk. Participants received subcutaneous semaglutide (0.5 mg or 1.0 mg once weekly) or placebo for a median 2.1 years. The primary composite outcome — cardiovascular death, nonfatal myocardial infarction, or nonfatal stroke — occurred in 6.6% of the semaglutide group versus 8.9% of placebo (HR 0.74, 95% CI 0.58–0.95, p<0.001 for non-inferiority; p=0.02 for superiority). Hemoglobin A1c reductions and body-weight reductions were also significantly greater with semaglutide.

Plain English

A multi-year study followed about 3,300 people with type 2 diabetes who were at high risk of heart disease. Half received semaglutide injections; half received placebo. People on semaglutide had fewer cardiovascular events (heart attacks, strokes, cardiovascular deaths) than those on placebo. They also had better blood sugar control and lost more weight.

Verified citations

3 · PubMed-checked

Reconstitution calculator

Subcutaneous (SQ)
Draw to20 units

= 0.2 mL on a U-100 insulin syringe

Concentration5 mg/mL
Doses / vial10

Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2–8°C after reconstitution. Use within 28 days.

Chemistry & PK

Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Half Life
Approximately 1 week
Degradation
Enzymatic degradation and renal clearance
Molecular Weight
4113.58
Molecular Formula
C187H291N45O59
Tissue Specificity
Acts on pancreatic beta cells, CNS appetite centers, liver, and GI tract

Bioavailability

Oral
Low (available as Rybelsus but with lower bioavailability)
Subq
High efficacy with weekly administration

Storage & handling

Lyophilized

Store pens and vials at 2-8°C before first use. After initial use, store at room temperature (15-30°C) for up to 30 days. Never freeze. Protect from light.

Reconstituted

Refrigerate at 2–8°C after reconstitution. Use within 28 days.

!

ContraindicationMedullary thyroid carcinoma / MEN2 — GLP-1 boxed warning

GLP-1 receptor agonists carry a boxed warning for medullary thyroid carcinoma (C-cell tumors seen in rodents at high doses; unconfirmed in humans). Contraindicated with a personal or family history of MTC or MEN2 — screen before starting. Note: Hashimoto's thyroiditis itself is NOT a contraindication; MTC is a separate, rare thyroid cancer.

!

MonitorGLP-1 alters oral progesterone absorption

Delayed gastric emptying changes oral progesterone (and other oral drug) absorption/timing — adjust co-prescribing.

!

MonitorGLP-1 constipation risk in bowel-endo

GLP-1 constipation is problematic in bowel-endometriosis/resection patients.

Legal / compounding

Research use only
EU
Approved
FDA
Approved for type 2 diabetes (Ozempic) and chronic weight management (Wegovy)
Canada
Approved
Australia
Approved

Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.