Semaglutide
peptide · headlineResearch use onlyGLP-1 receptor agonism: enhances insulin secretion, delays gastric emptying, reduces appetite
Overview
Semaglutide is a long-acting GLP-1 receptor agonist peptide used for weight management and glycemic control. It reduces appetite and caloric intake while enhancing insulin secretion and delaying gastric emptying. Available as Ozempic (for diabetes) and Wegovy (for obesity), it is a proven tool in treating metabolic syndrome and aiding fat loss when combined with lifestyle interventions.
How it works
- GLP-1 receptor agonism: enhances insulin secretion, delays gastric emptying, reduces appetite
- Suppresses glucagon secretion
- Acts on brain centers regulating appetite and satiety
Dosing
0.25 mg weekly for 4 weeks, titrated upward every 2–4 weeks to a maximum of 2.4 mg weekly.
Caution: Start at low dose to minimize GI side effects. Do not combine with other incretin-based therapies unless supervised.
Cycling
- Typical protocol: 0.25 mg/week for 4 weeks → 0.5 mg → 1 mg → 1.7 mg → 2.4 mg. Duration 12–24 weeks. Break for 4–6 weeks between cycles.
Side effects
- Common
- GI effects: nausea, vomiting, diarrhea, constipation — decrease with gradual titration
- Hypoglycemia risk when combined with insulin or sulfonylureas
- Warnings
- Rare: pancreatitis, gallbladder disease, acute kidney injury
- Thyroid C-cell tumors observed in rodents (human relevance uncertain)
Stacking & combinations
- With
MOTS-c
- Benefit
Supports retention of lean muscle mass during calorie restriction
- With
ARA-290
- Benefit
Enhances fat metabolism and lipolysis
- With
AOD-9604
- Benefit
Improves metabolic flexibility and may reduce leptin resistance
Lifestyle support
- Diet
Consistent meal schedule with whole foods, lean proteins, and vegetables. Monitor appetite changes. Stay well-hydrated (2–3 liters daily).
- Sleep
Adequate rest for metabolic support.
- Timing
Weekly injection. Consistent day each week.
- Exercise
Exercise 4–5 times weekly with mix of cardio and resistance.
Research studies
Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.
Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP-1)
Wilding JPH, Batterham RL, Calanna S, et al. N Engl J Med. 2021;384(11):989–1002. View source ↗
The STEP-1 trial randomized 1,961 adults with body mass index ≥30 (or ≥27 with weight-related comorbidities and without diabetes) to once-weekly subcutaneous semaglutide 2.4 mg or placebo for 68 weeks, alongside lifestyle intervention. Mean change in body weight was -14.9% in the semaglutide arm versus -2.4% in placebo. Secondary endpoints — including weight reduction ≥5%, ≥10%, and ≥15% — favored semaglutide with high statistical significance. Adverse events were predominantly gastrointestinal and consistent with the known GLP-1 receptor agonist class profile.
Researchers ran a large 68-week study comparing weekly semaglutide injections to placebo in nearly 2,000 adults with overweight or obesity (without diabetes). On average, the semaglutide group lost about 15% of their starting body weight; the placebo group lost about 2%. The most common side effects were stomach-related (nausea, diarrhea), which is typical for this class of molecule.
Semaglutide and Cardiovascular Outcomes in Patients with Type 2 Diabetes (SUSTAIN-6)
Marso SP, Bain SC, Consoli A, et al. N Engl J Med. 2016;375(19):1834–1844. View source ↗
SUSTAIN-6 was a randomized, double-blind cardiovascular outcomes trial in 3,297 patients with type 2 diabetes at high cardiovascular risk. Participants received subcutaneous semaglutide (0.5 mg or 1.0 mg once weekly) or placebo for a median 2.1 years. The primary composite outcome — cardiovascular death, nonfatal myocardial infarction, or nonfatal stroke — occurred in 6.6% of the semaglutide group versus 8.9% of placebo (HR 0.74, 95% CI 0.58–0.95, p<0.001 for non-inferiority; p=0.02 for superiority). Hemoglobin A1c reductions and body-weight reductions were also significantly greater with semaglutide.
A multi-year study followed about 3,300 people with type 2 diabetes who were at high risk of heart disease. Half received semaglutide injections; half received placebo. People on semaglutide had fewer cardiovascular events (heart attacks, strokes, cardiovascular deaths) than those on placebo. They also had better blood sugar control and lost more weight.
Verified citations
3 · PubMed-checked- Wegovy (semaglutide): a new weight loss drug for chronic weight management.clinicalPMID 34706925 ↗
- The Discovery and Development of Liraglutide and Semaglutide.mechanismPMID 31031702 ↗
- Safety of Semaglutide.reviewPMID 34305810 ↗
Reconstitution calculator
Subcutaneous (SQ)= 0.2 mL on a U-100 insulin syringe
Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2–8°C after reconstitution. Use within 28 days.
Chemistry & PK
- Sequence
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
- Half Life
- Approximately 1 week
- Degradation
- Enzymatic degradation and renal clearance
- Molecular Weight
- 4113.58
- Molecular Formula
- C187H291N45O59
- Tissue Specificity
- Acts on pancreatic beta cells, CNS appetite centers, liver, and GI tract
Bioavailability
- Oral
- Low (available as Rybelsus but with lower bioavailability)
- Subq
- High efficacy with weekly administration
Storage & handling
- Lyophilized
Store pens and vials at 2-8°C before first use. After initial use, store at room temperature (15-30°C) for up to 30 days. Never freeze. Protect from light.
- Reconstituted
Refrigerate at 2–8°C after reconstitution. Use within 28 days.
Used for
Contraindication — Medullary thyroid carcinoma / MEN2 — GLP-1 boxed warning
GLP-1 receptor agonists carry a boxed warning for medullary thyroid carcinoma (C-cell tumors seen in rodents at high doses; unconfirmed in humans). Contraindicated with a personal or family history of MTC or MEN2 — screen before starting. Note: Hashimoto's thyroiditis itself is NOT a contraindication; MTC is a separate, rare thyroid cancer.
Monitor — GLP-1 alters oral progesterone absorption
Delayed gastric emptying changes oral progesterone (and other oral drug) absorption/timing — adjust co-prescribing.
Monitor — GLP-1 constipation risk in bowel-endo
GLP-1 constipation is problematic in bowel-endometriosis/resection patients.
Legal / compounding
- EU
- Approved
- FDA
- Approved for type 2 diabetes (Ozempic) and chronic weight management (Wegovy)
- Canada
- Approved
- Australia
- Approved
Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.