Back to Peptides

Tirzepatide

Metabolic & Weight Loss

Tirzepatide is a dual GIP and GLP-1 receptor agonist peptide that provides powerful metabolic regulation for obesity and diabetes. Marketed as Mounjaro and Zepbound, it outperforms GLP-1 monotherapies in weight loss and glycemic control, and is under ongoing investigation for cardiometabolic risk reduction.

Reconstitute
2 mL BAC + 2.5mg vial
13 mcg/unit
Daily Range
2.5–15 mg Subcutaneous (SQ)
Once weekly
Standard Dose
See dosing
Cycle
4–8 weeks
then reassess
tirzepatideGLP-1GIPMounjaroZepbounddual agonistweight loss

Dosing & Reconstitution Guide

GI effects dose-dependent. Avoid combining with GLP-1 agonists unless supervised.

Standard / Gradual Approach

standard
PhaseDoseVolume
Week 12.5mg
Week 55mg
Week 910mg
Week 1315mg

Protocol Summary

Subcutaneous (SQ): Once weekly · Dose range 2.5–15 mg with gradual titration
Cycle Length: 4–8 weeks typical; reassess before extending

Frequency & Cycling

Subcutaneous

Start with 2.5mg once weekly for 4 weeks, then increase to 5mg once weekly for 4 weeks. Continue increasing by 2.5mg every 4 weeks until reaching the maximum dose of 15mg once weekly or the maximum tolerated dose.

🧪 Quick Start

Potential Benefits & Use Cases

Tirzepatide is approved for obesity and type 2 diabetes. Off-label use should follow clinical judgment.
Reduces HbA1c by 1.9–2.6% in SURPASS trials (FDA-approved)
Achieves up to ~11 kg more weight loss than GLP-1 receptor agonist comparators over 26 weeks (FDA-approved)
Improves lipid profiles, blood pressure, and hepatic steatosis markers (human trial)
Reduces heart failure events and improves cardiac markers (human trial)
Improves kidney function markers (human trial)
Significant proportion achieves >20% weight loss target (human trial)
Clinical data Strong preclinical Limited data

Mechanism of Action

→Dual GIP and GLP-1 receptor agonism
→Enhances insulin secretion and suppresses glucagon
→Delays gastric emptying and reduces appetite
→Modulates hypothalamic satiety signaling

Lifestyle & Optimization

timing

Weekly injection. Consistent day each week.

diet

Balanced meal plan focusing on whole foods and lean proteins. Monitor appetite — significantly reduces hunger. Stay well-hydrated (2–3 liters daily).

exercise

Exercise 4–5 times weekly with mix of cardio and resistance.

sleep

Adequate rest for metabolic support.

Peptide Research & Preclinical Studies

Evidence-Based Research Findings

Study TitleType
New England Journal of Medicine — Jastreboff AM et al. (2022) Tirzepatide Once Weekly for the Treatment of Obesity (SURMOUNT-1)Reference
NEJM — Frías JP et al. (2021) Tirzepatide vs. Semaglutide in Type 2 Diabetes (SURPASS-2)Reference
FDA — FDA approves Zepbound (tirzepatide) for chronic weight managementReference
Eli Lilly — Mounjaro (tirzepatide) prescribing informationReference
The Lancet — SURMOUNT-3/4: Tirzepatide long-term weight maintenanceReference
Nature Medicine — GIP/GLP-1 receptor agonist mechanism of actionReference

Side Effects & Safety

Common Side Effects

• Nausea, diarrhea (39–49% dose-dependent), vomiting, decreased appetite
• Headache, fatigue

Contraindications & Warnings

• Hypoglycemia (14–19% of users)
• Pancreatitis risk (FDA flagged)
• 37,800+ adverse event reports in FDA FAERS database

🧮 Dose Calculator

Concentration
12.5
mcg/unit
Draw Volume
40
units (0.400 mL)
For a 500 mcg dose, draw 40 units on a U-100 insulin syringe
🧬

Bioavailability & Absorption

SubQ Injection
High efficacy with weekly subcutaneous dosing
Oral Administration
Not available
Half-Life
5–6 days
Degradation
Proteolytic metabolism; renal and hepatic clearance
Tissue Specificity
Pancreatic beta cells, hypothalamus, GI tract, liver, adipose tissue
⚗️

Peptide Details

Molecular Weight
4812.51
Formula
C225H348N48O68
Sequence
YAEGTFTSDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
⚖️

Legal Status & Regulatory

RegionStatus
FDAApproved (Mounjaro for type 2 diabetes, Zepbound for obesity)
EUApproved
AustraliaPending
CanadaApproved

Storage Instructions

Lyophilized (Powder)
Store pens at 2-8°C before first use. After first use, store at room temperature (15-30°C) for up to 30 days. Never freeze. Protect from light.
Reconstituted (Mixed)
Refrigerate at 2–8°C after reconstitution. Use within 28 days.