Back to Peptides

Semaglutide

Metabolic & Weight Loss

Semaglutide is a long-acting GLP-1 receptor agonist peptide used for weight management and glycemic control. It reduces appetite and caloric intake while enhancing insulin secretion and delaying gastric emptying. Available as Ozempic (for diabetes) and Wegovy (for obesity), it is a proven tool in treating metabolic syndrome and aiding fat loss when combined with lifestyle interventions.

Reconstitute
2 mL BAC + 0.25mg vial
1 mcg/unit
Daily Range
0.25–2.4 mg Subcutaneous (SQ)
Once weekly
Standard Dose
1 mg
Cycle
4–8 weeks
then reassess
semaglutideGLP-1ozempicwegovyweight lossdiabetes

Dosing & Reconstitution Guide

Start at low dose to minimize GI side effects. Do not combine with other incretin-based therapies unless supervised.

Standard / Gradual Approach

25mg Vialstandard
PhaseDoseVolume
Week 10.25mg
Week 50.5mg
Week 91mg
Week 131.5-2.4mg

Protocol Summary

Subcutaneous (SQ): Once weekly · Dose range 0.25–2.4 mg with gradual titration
Cycle Length: 4–8 weeks typical; reassess before extending

Frequency & Cycling

SubQ Injection

Typical protocol: 0.25 mg/week for 4 weeks → 0.5 mg → 1 mg → 1.7 mg → 2.4 mg. Duration 12–24 weeks. Break for 4–6 weeks between cycles.

🧪 Quick Start

Vial Size
25 mg

Potential Benefits & Use Cases

Semaglutide is FDA-approved for type 2 diabetes and weight management but off-label use for physique enhancement is not authorized.
Reduces body weight by 10–15% at 2.4 mg weekly when combined with lifestyle modifications (FDA-approved)
Improves glycemic control through enhanced glucose-dependent insulin secretion (FDA-approved)
Reduces risk of major adverse cardiovascular events by 26% (human trial, SUSTAIN-6)
Reduces risk of major kidney events by 24% — slows eGFR decline and reduces albuminuria (human trial, FLOW)
Reduces all-cause mortality risk by 20% (human trial, SELECT)
Provides kidney protection in non-diabetics — 22% reduction in kidney composite endpoint (human trial, SELECT)
Convenient once-weekly dosing improves adherence (human trial)
Clinical data Strong preclinical Limited data

Mechanism of Action

→GLP-1 receptor agonism: enhances insulin secretion, delays gastric emptying, reduces appetite
→Suppresses glucagon secretion
→Acts on brain centers regulating appetite and satiety

Lifestyle & Optimization

timing

Weekly injection. Consistent day each week.

diet

Consistent meal schedule with whole foods, lean proteins, and vegetables. Monitor appetite changes. Stay well-hydrated (2–3 liters daily).

exercise

Exercise 4–5 times weekly with mix of cardio and resistance.

sleep

Adequate rest for metabolic support.

Peptide Research & Preclinical Studies

Evidence-Based Research Findings

Study TitleType
NEJM — Wilding JPH et al. (2021) Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1)Reference
FDA — FDA Approves New Drug Treatment for Chronic Weight Management (Wegovy)Reference
NEJM — Marso SP et al. (2016) SUSTAIN-6: Semaglutide and cardiovascular outcomesReference
Novo Nordisk — Ozempic (semaglutide) prescribing informationReference
The Lancet — STEP 5 trial: long-term effects of semaglutide on weightReference
Nature Medicine — GLP-1 receptor agonist cardiovascular and metabolic benefitsReference

Side Effects & Safety

Common Side Effects

• GI effects: nausea, vomiting, diarrhea, constipation — decrease with gradual titration
• Hypoglycemia risk when combined with insulin or sulfonylureas

Contraindications & Warnings

• Rare: pancreatitis, gallbladder disease, acute kidney injury
• Thyroid C-cell tumors observed in rodents (human relevance uncertain)

🧮 Dose Calculator

Concentration
1.3
mcg/unit
Draw Volume
400
units (4.000 mL)
For a 500 mcg dose, draw 400 units on a U-100 insulin syringe
🧬

Bioavailability & Absorption

SubQ Injection
High efficacy with weekly administration
Oral Administration
Low (available as Rybelsus but with lower bioavailability)
Half-Life
Approximately 1 week
Degradation
Enzymatic degradation and renal clearance
Tissue Specificity
Acts on pancreatic beta cells, CNS appetite centers, liver, and GI tract
⚗️

Peptide Details

Molecular Weight
4113.58
Formula
C187H291N45O59
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
⚖️

Legal Status & Regulatory

RegionStatus
FDAApproved for type 2 diabetes (Ozempic) and chronic weight management (Wegovy)
EUApproved
AustraliaApproved
CanadaApproved

Storage Instructions

Lyophilized (Powder)
Store pens and vials at 2-8°C before first use. After initial use, store at room temperature (15-30°C) for up to 30 days. Never freeze. Protect from light.
Reconstituted (Mixed)
Refrigerate at 2–8°C after reconstitution. Use within 28 days.