PACAP
peptide · headlineResearch use onlyActivates PAC1, VPAC1, and VPAC2 receptors in the CNS
Overview
PACAP (Pituitary Adenylate Cyclase-Activating Polypeptide) is a neuroprotective peptide with potent effects on neuron survival, cognition, and inflammation regulation. It has shown promise in models of Alzheimer’s, stroke, and cognitive decline, while also being studied for its role in migraine physiology.
How it works
- Activates PAC1, VPAC1, and VPAC2 receptors in the CNS
- Regulates cAMP and calcium-mediated intracellular pathways
- Inhibits apoptosis, inflammation, and oxidative damage in neurons
- Induces vasodilation via nitric oxide and cAMP signaling
Dosing
200 mcg intranasal 3–5x/week for up to 12 weeks. Adjust based on cognitive, migraine, or neuroprotective outcomes.
Caution: PACAP has been administered in rodents at 0.5–2.0 μg/kg for central nervous system research. It is not approved for any clinical use.
Cycling
- Cycle: 3–5x weekly for 6–12 weeks. Pause 2–4 weeks between cycles depending on response and migraine risk.
Side effects
- Common
- Mild flushing
- Dizziness
- Nasal irritation
- Warnings
- May provoke migraine attacks in sensitive populations
- Should be avoided during active vasospastic events
- Long Term
- Limited long-term studies in humans; generally well-tolerated in short-term protocols
Stacking & combinations
- With
Dihexa
- Benefit
Enhanced neuroregeneration when used with Dihexa
- With
Semax
- Benefit
Synergistic cognition enhancement when paired with Semax
- With
Cortexin
- Benefit
Neuroinflammation and stroke protection synergy with Cortexin
Lifestyle support
- Diet
Balanced nutrient-dense diet.
- Sleep
Consistent sleep schedule for optimal neuropeptide function. Manage stress through meditation.
- Timing
Consistent dosing schedule.
- Exercise
Exercise 3–4 times weekly. Engage in cognitive activities and mental stimulation.
Research studies
Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.
PACAP38 induces migraine-like attacks in patients with migraine without aura
Henrik Winther Schytz, Steffen Birk, Troels Wienecke, Christina Kruuse, Jes Olesen, Messoud Ashina Brain, 2009;132(Pt 1):16-25 View source ↗
In a double-blind, randomized crossover trial, intravenous infusion of PACAP38 (10 pmol/kg/min) versus vasoactive intestinal peptide (VIP) was administered to 12 patients with migraine without aura and 12 healthy controls. PACAP38 induced marked, prolonged dilation of the middle cerebral and superficial temporal arteries and provoked delayed migraine-like attacks in 7 of 12 migraine patients, whereas VIP did not induce delayed attacks. The results implicate the PACAP/receptor system in migraine pathophysiology and established PACAP38 as a human experimental trigger of migraine.
Researchers gave migraine patients a controlled infusion of the natural body peptide PACAP38 and compared it with a closely related peptide. PACAP38 widened blood vessels around the brain and triggered delayed migraine-like headaches in more than half of the patients, while the comparison peptide did not. This showed that PACAP is directly involved in causing migraine and pointed to it as a promising target for new migraine drugs.
Post-traumatic stress disorder is associated with PACAP and the PAC1 receptor
Kerry J Ressler, Kristina B Mercer, Bekh Bradley, Tanja Jovanovic, Amy Mahan, Kimberly Kerley, Seth D Norrholm, Varun Kilaru, Alicia K Smith, Amanda J Myers, Manuel Ramirez, Anzhelika Engel, Sayamwong E Hammack, Donna Toufexis, Karen M Braas, Elisabeth B Binder, Victor May Nature, 2011;470(7335):492-497 View source ↗
In a heavily traumatized civilian cohort, blood levels of PACAP peptide correlated with PTSD diagnosis and symptom severity in females but not males. A single-nucleotide polymorphism (rs2267735) in an estrogen-response element of the PAC1 receptor gene (ADCYAP1R1) predicted PTSD diagnosis, symptoms, fear discrimination, and altered methylation, again in a sex-specific manner. ADCYAP1R1 mRNA was also induced by fear conditioning in rodent models and by estrogen in cell culture, supporting a PACAP/PAC1 pathway underlying abnormal fear responses in PTSD.
Scientists studying trauma survivors found that higher levels of the stress peptide PACAP in the blood tracked with more severe PTSD symptoms, especially in women. A specific genetic variant in the PACAP receptor gene, one influenced by the hormone estrogen, predicted who developed PTSD and how strongly they reacted to fear cues. The work suggests PACAP helps explain why some people, particularly women, are more vulnerable to PTSD and could guide future stress-disorder treatments.
Investigation of the pathophysiological mechanisms of migraine attacks induced by pituitary adenylate cyclase-activating polypeptide-38
Faisal Mohammad Amin, Anders Hougaard, Henrik W Schytz, Mohammad S Asghar, Elisabet Lundholm, Arushma I Parvaiz, Patrick J H de Koning, Malene R Andersen, Henrik B W Larsson, Jan Fahrenkrug, Jes Olesen, Messoud Ashina Brain, 2014;137(Pt 3):779-794 View source ↗
Using high-resolution MR angiography in a double-blind crossover design, PACAP38 infusion induced migraine-like attacks accompanied by sustained dilation of extracranial arteries (middle meningeal and superficial temporal), while the middle cerebral artery showed no persistent dilation during attacks. Sumatriptan, a 5-HT1B/1D agonist, relieved the induced headache and selectively contracted the extracranial vessels. The findings localize PACAP38-triggered migraine to extracerebral rather than intracerebral arterial changes, refining the vascular component of migraine mechanisms.
Building on earlier work, researchers used detailed brain imaging to watch what happens when PACAP38 triggers a migraine. They found the headache was linked to widening of arteries outside the brain rather than inside it, and that the migraine drug sumatriptan both eased the pain and shrank those outer vessels. This clarified exactly which blood vessels are involved in PACAP-driven migraine and reinforced PACAP as a target for treatment.
Verified citations
2 · PubMed-checked- Effects of Pituitary Adenylate Cyclase Activating Polypeptide on Cell Death.mechanismPMID 35563353 ↗
- PACAP: Protective effects in stroke and dementia.reviewPMID 32445876 ↗
Reconstitution
After reconstitution, maintain at 2-8°C and use within 21-28 days. For intranasal application, transfer to spray bottle immediately.
Chemistry & PK
- Sequence
- HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
- Half Life
- Short; enhanced with stabilization carriers in IN formulations
- Degradation
- Rapidly degraded by dipeptidyl peptidases and neutral endopeptidases
- Molecular Weight
- 4571.2
- Molecular Formula
- C203H333N59O61S
- Tissue Specificity
- Central nervous system, particularly hippocampus, hypothalamus, and cortex
Bioavailability
- In
- High CNS bioavailability; preferred for neurological research
- Oral
- Not bioavailable due to enzymatic degradation
- Subq
- Variable, not a preferred route for CNS access
Storage & handling
- Lyophilized
Store lyophilized powder at 2-8°C
- Reconstituted
After reconstitution, maintain at 2-8°C and use within 21-28 days. For intranasal application, transfer to spray bottle immediately.
Used for
Legal / compounding
- EU
- Not Approved
- FDA
- Not Approved
- Canada
- Not Approved
- Australia
- Not Approved
Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.