Pepacorn
← Compounds

Tirzepatide

peptide · headlineResearch use only

Dual GIP and GLP-1 receptor agonism

Overview

Tirzepatide is a dual GIP and GLP-1 receptor agonist peptide that provides powerful metabolic regulation for obesity and diabetes. Marketed as Mounjaro and Zepbound, it outperforms GLP-1 monotherapies in weight loss and glycemic control, and is under ongoing investigation for cardiometabolic risk reduction.

How it works

  • Dual GIP and GLP-1 receptor agonism
  • Enhances insulin secretion and suppresses glucagon
  • Delays gastric emptying and reduces appetite
  • Modulates hypothalamic satiety signaling

Dosing

Start at 2.5 mg once weekly, titrate every 4 weeks to 5–15 mg as tolerated. Full cycles run 12–24 weeks.

Subcutaneous (SQ)range 2.515 mg· Once weekly

Caution: GI effects dose-dependent. Avoid combining with GLP-1 agonists unless supervised.

Cycling

  • Start with 2.5mg once weekly for 4 weeks, then increase to 5mg once weekly for 4 weeks. Continue increasing by 2.5mg every 4 weeks until reaching the maximum dose of 15mg once weekly or the maximum tolerated dose.

Side effects

Common
  • Nausea, diarrhea (39–49% dose-dependent), vomiting, decreased appetite
  • Headache, fatigue
Warnings
  • Hypoglycemia (14–19% of users)
  • Pancreatitis risk (FDA flagged)
  • 37,800+ adverse event reports in FDA FAERS database

Stacking & combinations

With

5-Amino-1MQ

Benefit

Boosts appetite suppression and dopaminergic tone

With

MOTS-c

Benefit

Helps preserve lean mass during caloric restriction

With

AOD-9604

Benefit

Improves mitochondrial metabolism and accelerates fat loss

Lifestyle support

Diet

Balanced meal plan focusing on whole foods and lean proteins. Monitor appetite — significantly reduces hunger. Stay well-hydrated (2–3 liters daily).

Sleep

Adequate rest for metabolic support.

Timing

Weekly injection. Consistent day each week.

Exercise

Exercise 4–5 times weekly with mix of cardio and resistance.

Research studies

Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.

Research study

Tirzepatide versus Semaglutide Once Weekly in Patients with Type 2 Diabetes (SURPASS-2)

Frías JP, Davies MJ, Rosenstock J, et al. N Engl J Med. 2021;385(6):503–515. View source ↗

Scientific findings

SURPASS-2 was a 40-week open-label, randomized, head-to-head trial of tirzepatide (5 mg, 10 mg, or 15 mg weekly) versus semaglutide 1 mg weekly in 1,879 patients with type 2 diabetes on metformin. Mean HbA1c reductions were -2.01% (5 mg), -2.24% (10 mg), -2.30% (15 mg) for tirzepatide versus -1.86% for semaglutide. Body weight reductions were -7.6, -9.3, -11.2 kg for the tirzepatide arms versus -5.7 kg for semaglutide. All tirzepatide doses met non-inferiority and superiority criteria for HbA1c reduction.

Plain English

Researchers directly compared tirzepatide to semaglutide in nearly 1,900 people with type 2 diabetes over 40 weeks. All three tested doses of tirzepatide led to bigger reductions in long-term blood sugar (HbA1c) and bigger weight loss than semaglutide. The highest tirzepatide dose led to about 25 pounds of weight loss on average, compared to about 13 pounds with semaglutide.

Research study

Tirzepatide Once Weekly for the Treatment of Obesity (SURMOUNT-1)

Jastreboff AM, Aronne LJ, Ahmad NN, et al. N Engl J Med. 2022;387(3):205–216. View source ↗

Scientific findings

SURMOUNT-1 randomized 2,539 adults with BMI ≥30 (or ≥27 with weight-related comorbidities and without diabetes) to tirzepatide 5 mg, 10 mg, or 15 mg weekly versus placebo for 72 weeks. Mean body-weight reductions were -15.0%, -19.5%, and -20.9% across the three tirzepatide doses versus -3.1% for placebo. The proportion achieving ≥20% weight reduction was 50% in the 15 mg group versus 3% in placebo. The adverse-event profile was consistent with the incretin class — predominantly gastrointestinal and typically transient.

Plain English

In a 72-week study of about 2,500 adults with overweight or obesity (no diabetes), people receiving weekly tirzepatide injections lost between 15% and 21% of their starting body weight, depending on dose. Placebo group lost about 3%. At the highest dose, half of participants lost 20% or more of their body weight. Side effects were mostly stomach-related and improved over time.

Verified citations

3 · PubMed-checked
  • Efficacy and safety of tirzepatide in type 2 diabetes (SURPASS-1): phase 3 trial.clinicalPMID 34186022
  • Tirzepatide is an imbalanced and biased dual GIP and GLP-1 receptor agonist.mechanismPMID 32730231
  • Tirzepatide, a dual GIP/GLP-1 receptor co-agonist for type 2 diabetes.reviewPMID 36050763

Reconstitution calculator

Subcutaneous (SQ)
Draw to50 units

= 0.5 mL on a U-100 insulin syringe

Concentration5 mg/mL
Doses / vial4

Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2–8°C after reconstitution. Use within 28 days.

Chemistry & PK

Sequence
YAEGTFTSDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Half Life
5–6 days
Degradation
Proteolytic metabolism; renal and hepatic clearance
Molecular Weight
4812.51
Molecular Formula
C225H348N48O68
Tissue Specificity
Pancreatic beta cells, hypothalamus, GI tract, liver, adipose tissue

Bioavailability

Oral
Not available
Subq
High efficacy with weekly subcutaneous dosing

Storage & handling

Lyophilized

Store pens at 2-8°C before first use. After first use, store at room temperature (15-30°C) for up to 30 days. Never freeze. Protect from light.

Reconstituted

Refrigerate at 2–8°C after reconstitution. Use within 28 days.

!

ContraindicationMedullary thyroid carcinoma / MEN2 — GLP-1 boxed warning

GLP-1 receptor agonists carry a boxed warning for medullary thyroid carcinoma (C-cell tumors seen in rodents at high doses; unconfirmed in humans). Contraindicated with a personal or family history of MTC or MEN2 — screen before starting. Note: Hashimoto's thyroiditis itself is NOT a contraindication; MTC is a separate, rare thyroid cancer.

!

MonitorGLP-1 alters oral progesterone absorption

Delayed gastric emptying changes oral progesterone (and other oral drug) absorption/timing — adjust co-prescribing.

!

MonitorGLP-1 constipation risk in bowel-endo

GLP-1 constipation is problematic in bowel-endometriosis/resection patients.

Legal / compounding

Research use only
EU
Approved
FDA
Approved (Mounjaro for type 2 diabetes, Zepbound for obesity)
Canada
Approved
Australia
Pending

Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.