Pepacorn
← Compounds

LL-37

peptide · headlineResearch use only

Disrupts microbial membranes via pore formation

Overview

LL-37 is a naturally occurring antimicrobial peptide in the cathelicidin family, integral to innate immune defense. It exerts antimicrobial, immunomodulatory, and wound-healing effects through membrane disruption, immune activation, and epithelial regeneration. Its applications span infectious disease, chronic wounds, and immune regulation.

How it works

  • Disrupts microbial membranes via pore formation
  • Neutralizes endotoxins such as lipopolysaccharides (LPS)
  • Activates chemokine and cytokine signaling for immune cell recruitment
  • Regulates toll-like receptor signaling pathways in epithelial and immune cells

Dosing

200 mcg SubQ daily or topical application 1–2x daily to affected site. Research-based; clinical protocols still under development.

Topical1 mg standardrange 0.52 mg· Applied once or twice daily depending on site and indication
Subcutaneous (SQ)200 mcg standardrange 100400 mcg· Daily or every other day depending on inflammatory severity

Caution: Research doses range from 1–5 μg/mL in vitro, or 1–10 mg/kg in animal models. LL-37 is not approved for use outside of the laboratory.

Cycling

  • 200–400 mcg daily or every other day for 4–6 weeks. Repeat cycles as needed with immune monitoring.
  • Apply to affected area once or twice daily. Safe for use in infected wounds, burns, or epithelial inflammation.

Side effects

Stacking & combinations

With

BPC-157

Benefit

Enhanced epithelial healing and immune priming

With

KPV

Benefit

Synergistic anti-inflammatory and mucosal protection

With

Thymosin Alpha-1

Benefit

Complementary antiviral and immune-enhancing effects

Lifestyle support

Diet

Optimize vitamin D status (upregulates endogenous LL-37). Adequate protein, zinc, and vitamin C for wound healing.

Sleep

Adequate sleep and stress management.

Timing

Consistent injection schedule during active infection or wound healing.

Exercise

Moderate activity as tolerated. Proper wound hygiene.

Research studies

Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.

Research study

In vitro and in vivo wound healing-promoting activities of human cathelicidin LL-37

Carretero M, Escámez MJ, García M, Duarte B, Holguín A, Retamosa L, Jorcano JL, Río MD, Larcher F Journal of Investigative Dermatology. 2008 Jan;128(1):223-36 View source ↗

Scientific findings

This mechanistic study showed that LL-37 activates migration of human HaCaT keratinocytes in vitro, driving actin cytoskeleton reorganization and increased tyrosine phosphorylation of proteins in focal adhesion complexes. Using adenoviral gene transfer of LL-37 to full-thickness excisional wounds in diabetic, healing-impaired ob/ob mice, the peptide significantly enhanced re-epithelialization and granulation tissue formation in vivo. The work established that LL-37's benefit in wound repair is a direct pro-regenerative effect on host skin cells, distinct from its antimicrobial killing.

Plain English

Beyond fighting germs, LL-37 helps skin heal. In lab dishes it prompted skin cells to move and close gaps, and in wounds on diabetic mice that normally heal poorly, delivering extra LL-37 sped up the regrowth of skin and healthy new tissue. This showed LL-37 actively helps the body rebuild wounded skin, not just keep it clean.

Research study

A comprehensive summary of LL-37, the factotum human cathelicidin peptide

Vandamme D, Landuyt B, Luyten W, Schoofs L Cellular Immunology. 2012 Nov;280(1):22-35 View source ↗

Scientific findings

This peer-reviewed review synthesizes LL-37's dual role as a broad-spectrum, membrane-disrupting antimicrobial peptide and a multifunctional immunomodulator. It details how the cationic, amphipathic 37-residue peptide (cleaved from hCAP18) permeabilizes microbial membranes, neutralizes LPS/endotoxin, and inhibits biofilms, while also driving chemotaxis of neutrophils, monocytes and lymphocytes, modulating cytokine production, and promoting angiogenesis and wound healing. Being a review, it is mechanistic and integrative rather than reporting new primary experimental data.

Plain English

This overview pulls together what is known about LL-37, a natural peptide our own immune cells make. It explains the two big jobs the peptide does: punching holes in bacteria to kill them, and acting as a signal that recruits and coordinates immune cells while helping tissues heal. It is a useful map of why this one small molecule matters across infection, inflammation and repair.

Research study

Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial

Mahlapuu M, Sidorowicz A, Mikosinski J, Krzyżanowski M, Orleanski J, Twardowska-Saucha K, Nykaza A, Dyaczynski M, Belz-Lagoda B, Dziwiszek G, Kujawiak M, Karczewski M, Sjöberg F, Grzela T, Wegrzynowski A, Thunarf F, Björk J, Ekblom J, Jawien A, Apelqvist J Wound Repair and Regeneration. 2021 Nov;29(6):938-950 View source ↗

Scientific findings

This phase IIb double-blind, randomized, placebo-controlled clinical trial (HEAL LL-37) tested topical LL-37 (0.5 or 1.6 mg/mL) plus compression therapy in 148 patients with hard-to-heal venous leg ulcers. The primary efficacy analysis over the full population found no statistically significant improvement in healing versus placebo, though the 0.5 mg/mL dose showed a significant odds ratio (~3.25) for reaching 50% wound closure, and a post hoc analysis found significant benefit in patients with large wounds (>=10 cm2). Treatment was safe and well tolerated across doses.

Plain English

This was a real human trial in patients with stubborn leg ulcers that will not heal. Applying LL-37 to the wound was safe, but overall it did not clearly beat placebo at healing the ulcers; hints of benefit appeared for partial wound closure and for the largest wounds. It shows the peptide is promising and safe but not yet a proven cure, which is why researchers are still refining the dose and target patients.

Verified citations

2 · PubMed-checked
  • LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity.reviewPMID 27117377
  • Cathelicidin peptide LL-37: A multifunctional peptide involved in heart disease.reviewPMID 39615616

Reconstitution calculator

Subcutaneous (SQ)
Draw to4 units

= 0.04 mL on a U-100 insulin syringe

Concentration5 mg/mL
Doses / vial50

Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2–8 °C (35.6–46.4 °F) for up to 4 weeks; frozen at −20 °C (−4 °F) for up to 6 months

Chemistry & PK

Sequence
[LL-37, 37 aa]
Half Life
Short systemic half-life; effects are mostly local and transient
Degradation
Metabolized by tissue proteases and immune-related enzymes
Molecular Weight
4493.3
Molecular Formula
C62H114N18O19
Tissue Specificity
Active in skin, lungs, oral cavity, GI tract, and mucosal surfaces

Bioavailability

Oral
Poor bioavailability due to rapid enzymatic breakdown
Subq
High when injected; effects mostly localized to immune and epithelial tissues

Storage & handling

Lyophilized

freeze at −20 °C (−4 °F); after reconstitution, refrigerate at 2–8 °C (35.6–46.4 °F) for up to 4 weeks; avoid freeze–thaw cycles

Reconstituted

Refrigerate at 2–8 °C (35.6–46.4 °F) for up to 4 weeks; frozen at −20 °C (−4 °F) for up to 6 months

!

ContraindicationCationic peptides can worsen MCAS (MRGPRX2 degranulation)

LL-37, VIP/PACAP and full α-MSH degranulate human mast cells via MRGPRX2 — avoid in mast-cell patients. KPV is safe (NF-κB pathway).

Legal / compounding

Research use only
EU
Not Approved
FDA
Not Approved
Canada
Not Approved
Australia
Not Approved

Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.