IGF-1 LR3
peptide · headlineResearch use onlyBinds to IGF-1 receptors to stimulate cellular proliferation and protein synthesis
Overview
IGF-1 LR3 is a long-acting analog of insulin-like growth factor-1 engineered for enhanced bioavailability and prolonged action. It binds IGF-1 receptors in muscle and bone to stimulate anabolic growth, repair, and recovery. It is studied for its role in cell proliferation, muscle growth, and tissue regeneration in animal models and in vitro systems.
How it works
- Binds to IGF-1 receptors to stimulate cellular proliferation and protein synthesis
- Inhibits apoptosis and promotes muscle cell repair
- Extended half-life reduces binding to IGFBPs, enhancing tissue absorption
Dosing
Typical dose: 50 mcg daily SubQ post-workout or in the morning. Cycle 4–6 weeks on, followed by 4 weeks off.
Caution: In preclinical studies, IGF-1 LR3 is used at 20–100 μg/kg depending on species and study design. These values do not translate to safe or approved human dosing.
Cycling
- Administer daily at 40–100 mcg post-exercise or in the morning. Suggested cycle: 4–6 weeks on, 4 weeks off to avoid receptor desensitization.
Side effects
- Common
- Hypoglycemia — shakiness, confusion, sweating, dizziness; always administer with food
- Dose-dependent safety concerns above 50–60 mcg/day
- Receptor desensitization after 6–8 weeks continuous use; cycling recommended (8 on/4–8 off)
Stacking & combinations
- With
GHRP-2
- Benefit
Enhanced GH secretion complements IGF-1 activity for greater anabolic effect
- With
PEG MGF
- Benefit
Supports synergistic repair and hypertrophy of muscle tissue
Lifestyle support
- Diet
High protein diet essential. Avoid high-carb meals around injection timing.
- Sleep
Natural GH pulses during deep sleep synergize with exogenous IGF-1.
- Timing
Post-workout injection preferred. Avoid injection around meals (insulin interference).
- Exercise
Heavy resistance training maximizes anabolic response.
Research studies
Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.
Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency
Francis GL, et al. J Mol Endocrinol. 1992;8(3):213-223. View source ↗
This foundational study produced and characterized Long-[Arg3]-IGF-I (LR3), which combines a 13-residue N-terminal extension with a Glu3-to-Arg3 substitution. In cell lines that secrete IGF binding proteins (e.g., L6 myoblasts), LR3-IGF-I was substantially more potent than native IGF-I at stimulating protein synthesis, whereas in cells lacking detectable IGFBP secretion it was actually less potent, demonstrating that the enhanced biological potency derives from reduced IGFBP binding rather than increased affinity for the type 1 IGF receptor. The work established the mechanistic rationale that LR3's activity depends on escaping IGFBP sequestration to raise the free, receptor-available fraction.
Researchers engineered the modified growth factor now called IGF-1 LR3 and tested it in cell cultures. It worked more strongly than ordinary IGF-1, but only in cells that release the carrier proteins that normally trap IGF-1; in cells without those carriers it was weaker. This showed that LR3's extra strength comes from avoiding being bound up by carrier proteins, not from binding the growth-factor receptor more tightly. The study was done entirely in cell culture, not in people.
Long R3 insulin-like growth factor-I (IGF-I) infusion stimulates organ growth but reduces plasma IGF-I, IGF-II and IGF binding protein concentrations in the guinea pig
Conlon MA, et al. J Endocrinol. 1995;146(2):247-253. View source ↗
Continuous infusion of Long-R3-IGF-I in guinea pigs stimulated growth of specific organs (notably the spleen, kidney and gut) while paradoxically lowering circulating endogenous IGF-I, IGF-II and IGF binding protein concentrations, consistent with negative feedback suppression of the somatotropic axis. Because LR3 binds IGFBPs poorly, it distributes and acts differently from native IGF-I, driving tissue growth even as it depresses the endogenous IGF system. The findings illustrate both the anabolic organ-specific effects and the systemic feedback consequences of a poorly-IGFBP-bound analog in a live animal model.
In guinea pigs, giving IGF-1 LR3 continuously made certain organs grow larger, but at the same time it lowered the animals' own natural IGF-1 and its carrier proteins in the blood. This suggests the body senses the extra activity and dials back its own production as a feedback response. It is an animal study that highlights both growth effects and the potential to disrupt the body's normal growth-factor balance.
Insulin-like growth factor I (IGF-I) and long R(3)IGF-I differently affect development and messenger ribonucleic acid abundance for IGF-binding proteins and type I IGF receptors in in vitro produced bovine embryos
Prelle K, et al. Endocrinology. 2001;142(3):1309-1316. View source ↗
In in vitro-produced bovine embryos, native IGF-I and Long-R3-IGF-I exerted distinct effects on developmental competence and on mRNA abundance for IGF binding proteins and the type 1 IGF receptor, indicating that the two ligands are not interchangeable despite acting through the same receptor. The differences were attributed to LR3's reduced IGFBP binding, which alters local ligand availability and downstream transcriptional regulation of the IGF axis in developing embryos.
When added to cattle embryos grown in the lab, ordinary IGF-1 and IGF-1 LR3 had different effects on how the embryos developed and on which growth-related genes were switched on. This means the modified version does not simply mimic natural IGF-1 even though they use the same receptor. The work is from reproductive and agricultural research, not human medicine.
Verified citations
2 · PubMed-checked- The emerging landscape of performance-enhancing peptides modulating GH-IGF1 axis.reviewPMID 42395176 ↗
- Differential effects of IGF-I (LR3-IGF-I) and gonadotropins on granulosa cell proliferation.preclinicalPMID 11334915 ↗
Reconstitution calculator
Subcutaneous (SQ)= 0.01 mL on a U-100 insulin syringe
Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2-8°C. Use within 2-3 weeks. Highly perishable.
Chemistry & PK
- Sequence
- MFPAMPLSSLVLARLLINGNRGPEETLCGAELVDALQFVCGDRGFYFSRPASRPPPGSRPLPVMTLSRRQLAVGRVRYGLRLLGTPGD
- Half Life
- 20–30 hours
- Degradation
- Processed by hepatic and renal clearance
- Molecular Weight
- 9111.6
- Molecular Formula
- C990H1528N262O300S7
- Tissue Specificity
- Targets skeletal muscle, cartilage, and bone growth sites
Bioavailability
- Oral
- Very low; degraded in digestive system
- Subq
- High; bypasses GI tract and avoids IGFBP binding due to LR3 modification
Storage & handling
- Lyophilized
Store lyophilized powder at -20°C. Extremely temperature-sensitive. Must remain frozen until ready to reconstitute. Do not freeze reconstituted solution. Avoid repeated freeze-thaw cycles.
- Reconstituted
Refrigerate at 2-8°C. Use within 2-3 weeks. Highly perishable.
Legal / compounding
- EU
- Not Approved
- FDA
- Not Approved
- Canada
- Not Approved
- Australia
- Not Approved
Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.