IGF-1 LR3

IGF-1 LR3 is a long-acting analog of insulin-like growth factor-1 engineered for enhanced bioavailability and prolonged action. It binds IGF-1 receptors in muscle and bone to stimulate anabolic growth, repair, and recovery. It is studied for its role in cell proliferation, muscle growth, and tissue regeneration in animal models and in vitro systems.

• Binds to IGF-1 receptors to stimulate cellular proliferation and protein synthesis
• Inhibits apoptosis and promotes muscle cell repair
• Extended half-life reduces binding to IGFBPs, enhancing tissue absorption

• unit: mcg

  low dose: 30

  frequency: Daily

  high dose: 100

  standard dose: 50

  administration route: Subcutaneous (SQ)

• Administer daily at 40–100 mcg post-exercise or in the morning. Suggested cycle: 4–6 weeks on, 4 weeks off to avoid receptor desensitization.

common: ["Hypoglycemia — shakiness, confusion, sweating, dizziness; always administer with food","Dose-dependent safety concerns above 50–60 mcg/day","Receptor desensitization after 6–8 weeks continuous use; cycling recommended (8 on/4–8 off)"]

sequence: MFPAMPLSSLVLARLLINGNRGPEETLCGAELVDALQFVCGDRGFYFSRPASRPPPGSRPLPVMTLSRRQLAVGRVRYGLRLLGTPGD

half life: 20–30 hours

degradation: Processed by hepatic and renal clearance

molecular weight: 9111.6

molecular formula: C990H1528N262O300S7

tissue specificity: Targets skeletal muscle, cartilage, and bone growth sites

• The emerging landscape of performance-enhancing peptides modulating GH-IGF1 axis.reviewPMID 42395176 ↗
• Differential effects of IGF-I (LR3-IGF-I) and gonadotropins on granulosa cell proliferation.preclinicalPMID 11334915 ↗