Pepacorn
← Compounds

Exenatide

peptide · headlineFDA-approved

Enhances glucose-dependent insulin secretion

Overview

Exenatide is a GLP-1 receptor agonist approved for type 2 diabetes treatment. It mimics incretin hormones to stimulate insulin secretion in a glucose-dependent manner, suppresses glucagon, delays gastric emptying, and aids in weight reduction. Available in twice-daily and weekly extended-release formulations, it also shows potential benefits in hepatic fat reduction and neuroprotection.

How it works

  • Enhances glucose-dependent insulin secretion
  • Suppresses inappropriately elevated glucagon secretion
  • Slows gastric emptying and reduces postprandial glucose spikes

Dosing

Start with 5 mcg SubQ twice daily before meals; increase to 10 mcg if tolerated. For extended-release, 2 mg once weekly.

Subcutaneous (SQ)5 mcg standardrange 510 mcg· Twice daily
Subcutaneous (SQ)2 mg standardrange 22 mg· Once weekly (extended-release formulation)

Caution: Do not exceed 10mcg twice daily. Common side effects include nausea, which typically diminishes with continued use. Pancreatitis risk exists; discontinue immediately if severe abdominal pain occurs.

Cycling

  • Immediate-release: Inject twice daily within 60 minutes before morning and evening meals. Extended-release: Inject 2 mg SubQ once weekly. Continuous use; monitor glucose, A1c, and GI tolerance.

Side effects

Common
  • Nausea
  • Vomiting
  • Diarrhea
Warnings
  • Risk of acute pancreatitis
  • Caution in patients with renal impairment
Long Term
  • Potential risk of thyroid C-cell tumors (observed in rodents)

Stacking & combinations

With

Semaglutide

Benefit

Both GLP-1 agonists; combined use may enhance weight loss and metabolic effects

With

Tirzepatide

Benefit

GLP-1/GIP agonist combination; complementary mechanism for enhanced glucose control

With

AOD-9604

Benefit

Fat-loss peptide; stacks with Exenatide for enhanced body composition improvements

Lifestyle support

Diet

Maintain caloric deficit of 300–500 calories. Lean proteins, vegetables, complex carbohydrates. Stay hydrated with 2–3 liters water daily.

Sleep

Adequate sleep for metabolic recovery.

Timing

Inject 60 minutes before meals. Consistent timing daily.

Exercise

Regular exercise 4–5 times weekly (both cardio and resistance).

Research studies

Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.

Research study

Exenatide once weekly versus placebo in Parkinson's disease: a randomised, double-blind, placebo-controlled trial

Athauda D, Maclagan K, Skene SS, Bajwa-Joseph M, Letchford D, Chowdhury K, Hibbert S, Budnik N, Zampedri L, Dickson J, Li Y, Aviles-Olmos I, Warner TT, Limousin P, Lees AJ, Greig NH, Tebbs S, Foltynie T Lancet. 2017 Oct 7;390(10103):1664-1675 View source ↗

Scientific findings

In this double-blind, placebo-controlled trial, 62 patients with moderate Parkinson's disease were randomised to subcutaneous exenatide 2 mg once weekly or placebo for 48 weeks, followed by a 12-week washout. The primary endpoint, the adjusted difference in practically defined off-medication MDS-UPDRS Part 3 motor score at 60 weeks, favoured exenatide by 3.5 points (95% CI -6.7 to -0.3; p=0.0318), with the exenatide group showing a +1.0-point improvement versus a -2.1-point decline on placebo. Because the motor advantage persisted after the 12-week washout, when exenatide would have been cleared, the authors raised the possibility of a disease-modifying rather than purely symptomatic effect, though they cautioned this required confirmation.

Plain English

Researchers tested a diabetes drug, exenatide, given as a weekly injection, in 62 people with Parkinson's disease over roughly a year. People on exenatide had modestly better movement scores than those on dummy injections, and the benefit lasted even after they stopped the drug for 12 weeks. This hinted the drug might slow the disease itself rather than just mask symptoms, but larger studies were needed to be sure.

Research study

Exenatide and the treatment of patients with Parkinson's disease

Aviles-Olmos I, Dickson J, Kefalopoulou Z, Djamshidian A, Ell P, Soderlund T, Whitton P, Wyse R, Isaacs T, Lees A, Limousin P, Foltynie T Journal of Clinical Investigation. 2013 Jun;123(6):2730-6 View source ↗

Scientific findings

This single-blind, controlled proof-of-concept study assigned 45 patients with moderate Parkinson's disease to either exenatide 5 microg twice daily (later 10 microg) subcutaneously for 12 months or to act as controls, all continuing conventional therapy. Exenatide-treated patients showed a mean improvement of 2.7 points on the MDS-UPDRS at 12 months versus a mean decline of 2.2 points in controls (p=0.037), with parallel advantages on cognitive testing (Mattis Dementia Rating Scale). The benefits, though the trial was open-label and small, provided the first clinical signal supporting the neuroprotective/neurorestorative effects of GLP-1 receptor agonism observed in preclinical models and motivated the subsequent double-blind trial.

Plain English

This early study gave exenatide to 45 people with Parkinson's disease for a year and compared them with untreated patients. Those on the drug improved slightly on movement and thinking tests, while the comparison group got worse. Because it was a small, non-blinded study the findings were preliminary, but they were encouraging enough to justify a rigorous follow-up trial.

Research study

Effects of exenatide (exendin-4) on glycemic control and weight over 30 weeks in metformin-treated patients with type 2 diabetes

DeFronzo RA, Ratner RE, Han J, Kim DD, Fineman MS, Baron AD Diabetes Care. 2005 May;28(5):1092-100 View source ↗

Scientific findings

This triple-blind, placebo-controlled 30-week trial randomised 336 patients with type 2 diabetes inadequately controlled on metformin to placebo or exenatide 5 or 10 microg twice daily. Exenatide 10 microg reduced HbA1c by 0.78% versus placebo (placebo essentially unchanged), and 46% of the high-dose group reached HbA1c <=7% versus 13% on placebo. Exenatide also produced dose-dependent, progressive weight loss (approximately 2.8 kg with the 10 microg dose) with no increase in hypoglycaemia; mild-to-moderate nausea was the most common adverse effect.

Plain English

In people with type 2 diabetes whose blood sugar was not well controlled by metformin alone, adding twice-daily exenatide injections meaningfully lowered long-term blood sugar (HbA1c) compared with placebo. Patients also lost weight rather than gaining it, which is unusual for diabetes drugs, and did not have more episodes of dangerously low blood sugar. The main side effect was mild-to-moderate nausea.

Verified citations

2 · PubMed-checked

Reconstitution calculator

Subcutaneous (SQ)
Draw to0.1 units

= 0.001 mL on a U-100 insulin syringe

Concentration5 mg/mL
Doses / vial2,000

Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2–8°C after reconstitution. Use within 28 days.

Chemistry & PK

Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Half Life
2.4 hours (immediate-release); approximately 6 to 7 days (extended-release).
Degradation
Primarily degraded by DPP-4 enzyme and cleared renally.
Molecular Weight
4186.6
Molecular Formula
C184H282N50O60
Tissue Specificity
Targets pancreatic beta cells, central appetite centers, and slows gastric emptying.

Bioavailability

Oral
Not available as an oral tablet; low oral bioavailability.
Subq
Good bioavailability via subcutaneous injection.

Storage & handling

Lyophilized

Store pens at 2-8°C before first use. After initial use, may be stored at room temperature (15-30°C) for up to 30 days. Never freeze. Protect from light.

Reconstituted

Refrigerate at 2–8°C after reconstitution. Use within 28 days.

Legal / compounding

FDA-approved
EU
Approved
FDA
Approved
Canada
Approved
Australia
Approved

Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.